In computer programming instant, shameâfree feedback is praised as a powerful form of testing; the author contrasts this with traditional standardized schooling, accusing teachers of treating grades merely as motivation tools, lacking selfâreflection, and viewing students as revenue sources rather than learners; he argues that such systems breed fear of failure, hinder problem solving, and betray childrenâwho then reject school not because they are poor or mean but because it lacks authenticityâand calls for teachers to provide genuine, instant feedback so that failure becomes a compass for learning, promising that authentic selfâeducation will make schools wiser and brighter.
#0932 published 05:02 audio duration436 wordsprogrammingeducationinstant-feedbackteststeachersstudentsself-evaluationstandardized-testslearning
A tutorial is a stepâbyâstep learning tool that can be powerful when organized into a coherent series of lectures, but often loses its value once itâs converted into a formal college program that merely mimics the original structure and adds noise. The post contrasts tutorials with manuals and cookbooksâeach useful in its own wayâbut notes that tutorials still lack crossâlinks to other topics, limiting deeper understanding. The author stresses that a good professor can bridge those gaps, guiding students through linked concepts, while institutional degrees often become frauds when students simply memorize rather than internalize the material.
#0931 published 06:21 audio duration508 wordstutoriallecturecookbookmanualstep-by-stepeducationcollegelearningadventure
I began diagramming in sixth grade with a simple lotteryâsimulation program, and that early practice evolved into a lifelong tool for visualizing ideasâfrom the Geometry Nodes in Blender to handâdrawn concept mapsâand now I use free digital art programs like Krita and openâsource mindâmapping tools such as FreeMind to build large, flexible diagrams; these mixed, sometimes âincoherent doodleââstyle charts blend mental webs of lines and labels with tangible paper or canvas so that concepts stay vivid in memory, can be rearranged on the fly, and ultimately help me think wider, learn faster, and master everything from 3D modeling to programming.
#0930 published 06:06 audio duration534 wordsdiagrammingmind-mappingconcept-mappingfree-and-open-sourceblendergeometry-nodeskritaprogrammingmemory-palace
Iâve been crafting web pages for years, starting with basic HTML and ASP, then moving on to Perl, PHP, ActionScript, Java, and finally Node.jsâall while learning by building buttons and other elements. Using simple tools like Notepad, I discovered how much code can be learned through handsâon practice, and each new language added to my growing toolbox. The journey feels like a fun game, where the keyboard becomes your toolset; if you take the first step into JavaScript, youâll find yourself well equipped for further adventures in programming. Give it a try todayâwatch a JavaScript tutorial video and dive in!
#0929 published 01:39 audio duration146 words1 linkhtmlaspperlphpactionscriptjavanodejsjavascriptweb-developmentprogramming-learning
The post argues that true comprehension comes from materials organized for easy access, learning is an art that requires individualized instruction paced to each studentâs comfort, and that modern schools fail by treating one teacher per many students, forcing memorization and disconnected lessons that match state tests but not real understanding; it calls for a return to authentic selfâeducation through booksâhundreds or thousands of narrated worksâto transform individuals and, ultimately, civilization.
#0928 published 05:56 audio duration369 wordseducationlearningtutoringpersonalizedlearninginstructionaldesignbookreadingselfstudyschoolcurriculum
By following your own curiosities and talents, you can build a lifelong, selfâdriven education that constantly expands as you experiment with new combinations of knowledge. The post contrasts this organic learning processâwhere each discovery feels fresh and meaningfulâwith the formal academic system that often treats learning as a means to obtain credentials rather than true understanding. It urges you to tap into freely available resourcesâvideos, books, openâsource programsâand actively seek out subjects that ignite your interest, because only through authentic, selfâguided exploration can you grow wiser and become âmore of yourself.â
#0927 published 03:42 audio duration308 wordsself-educationlearningcuriositypersonal-developmentopen-sourcetutorialsvideosbooksinternetsubjects
Real education is an adventurous journey of exploration and continuous learning: each new experienceâwhether through reading narrated books from the library or visiting museums, craters, mountains, shipwrecks, and other placesâadds layers of knowledge refined by wise thinkers. By revisiting these sources repeatedly we deepen our understanding and sharpen decisionâmaking skills that guide future choices such as school, career, and life direction. The post stresses that learning starts early, grows with practice, and culminates in wisdom that shapes a lifetime of informed decisions, urging readers to trust their first thousand narrated books as the foundation for this lifelong quest.
#0926 published 04:05 audio duration341 wordspoetryeducationbookslibrarytravel
The author proposes using an inexpensive singleâboard computerâspecifically a RaspberryâŻPi 4 kit costing under $200âas a practical development machine that forces efficient coding; he explains how such a slow system reveals performance bottlenecks (e.g., CPU fan noise) and encourages writing code that processes data in streams or with inâmemory caches, citing examples from Node.js stream processing, XML databases, and Java crashes to illustrate the need for lightweight solutions. He then outlines a distributed-processing pattern using ZeroMQ and many RaspberryâŻPi Zeros, showing how scaling can be achieved by adding more machines, and concludes that mastering efficient code through selfâeducation not only saves money but also positions one as a valuable developer capable of building competitive systems.
In the post, the writer reflects on creative growth, arguing that each new artwork should surpass its predecessor, and stresses how a comprehensive, realâlife educationâencompassing digital art, design, programming, 3D modeling, circuit design, music composition, and applied philosophyâis essential for young people to shape the future. He presents integrated subjects such as math framed within drone design and generative art, noting that true learning emerges from contextualized knowledge rather than isolated facts. The writer frames selfâeducation as a lifelong quest of reading thousands of books (and even writing new ones), envisioning it as the means by which individuals can build tomorrowâs world with longâterm vision and become lovers of wisdom.
The post argues that cultural progress hinges on embracing narrated books from leading intellectuals; by learning through these worksârepeatedly and reflectivelyâpeople can absorb the best ideas while shedding outdated ones. It stresses that education, not mere tradition, drives growth, and that a personal library of powerful narratives equips individuals to resist deception and manipulation. In essence, continuous study of transformative books enriches culture, unites it with global wisdom, and safeguards it against exploitation.
#0923 published 04:13 audio duration372 wordsculturebooksnarrationpersonal-libraryeducationmodernisationknowledge
The post argues that many of societyâs systemsâgrades, borders, wars, prisons, schoolsâare mere games or rituals that mask underlying problems such as poverty and miscommunication. It suggests simple fixes like universal basic income and better education but claims we still pretend the current systems are working. To break out of these âgames,â it encourages personal initiative: start learning programming, digital arts, and entrepreneurship from highâschool years, build small startups until you find one that works, then grow your skills and knowledge. The author sees this as a quest for authenticity, urging readers to write books, keep learning, and dedicate themselves to selfâeducation so they can âgrow all the way upâ and become great beings.
#0922 published 05:03 audio duration414 words3 linkseducationstartupsprogrammingdigital-music-composition3d-modelingdigital-painting
The post explains the âfenceâpostâ problem that arises in programming when counting elements of a list (or array) and using zeroâbased indices. By walking through an example with three apples, it shows how to set up a forâloop: initialize the counter at 0, use the condition âcounterâŻ<âŻarray.lengthâ, and increment the counter each iteration; this yields counters 0,âŻ1,âŻ2 and stops before reaching 3, which is the correct loop boundary. The author also discusses common mistakes such as using ââ¤â instead of â<â or starting at 1, and notes that while some libraries choose to expose a oneâbased page number for convenience, the underlying code should still be zeroâbased for consistency. In short, the article illustrates why programmers must remember that array indices begin at 0 and loop conditions should reflect that fact.
#0921 published 06:58 audio duration594 words1 linkfence post problemzero based indexingarray loopsjavascriptfor loop
The author argues that the traditional school system relies on rigid preârequisite classes, timed lectures, and rote memorization designed for state tests rather than genuine learning, so teachers can easily earn salaries by moving students through a fixed sequence of facts. He claims real education should be driven by student curiosity, project work, and flexible, handsâon experiencesâlike building 3D printers or creating musicâthat let learners discover concepts naturally. The post calls for abandoning strict subject divisions and allowing students to pursue interests at their own pace, suggesting that true learning happens when teachers act as facilitators rather than schedulers of memorization.
#0920 published 15:10 audio duration1,189 words3 linkseducationschoolsteachersclassroomsprerequisitesprojectsself-learning3dprintingraspberrypiprogrammingartclassesmusiccomposition
The author reflects on human nature as an inherent drive toward growth, safety, and selfâeducation, arguing that wars, poverty, and weak schooling systems have thwarted the cultivation of true talent. He critiques conventional education for delivering only ânoiseâ and superficial knowledge, claiming teachers often fail to turn lessons into real skills; a programming class should produce a working coder, an art lesson should yield genuine painting ability, and a 3âD modeling course should culminate in a tangible creation. The post stresses that the responsibility of learning lies with each individual: by actively pursuing curiosity, turning it into talent, and taking ownership of oneâs own education, we can become âgreat beingsâ and help rebuild a culture where nurture, wisdom, and lifelong learning replace institutional paychecks.
#0919 published 07:18 audio duration651 wordshuman naturenurtureeducationself-educationculturewarpoverty
The post argues that learning any new skillâwhether a language, programming, or artâis driven by practical context rather than textbook theory; just taking classes produces rote memorization and âgibberishâ work, while actually writing programs (or building static site generators) forces deeper understanding and quick mastery. It illustrates this with examples from 3âD modeling, where having a printer as a concrete tool anchors learning, and digital painting, where using reference images streamlines composition and color work. The author concludes that schools often deliver only shallow context, stifling creativity, and calls for real-world learning environments that yield lasting results.
#0918 published 06:26 audio duration535 words1 linklanguage-learningprogrammingstatic-site-generator3d-modelingdigital-painting
The narrator begins by recalling how âMotherâŻNatureâ invited him into her woodland world, only to return home after days of solitude, reading books and reflecting on his own appearance; he then recounts vivid memories of watching the Hel Peninsula from the Baltic Sea, strolling along the Great Lakes and Nordhouse Dunes, and enjoying nights with seagull companionsâhis âsea catsâ that made the moonlit evenings feel blessedâand concludes that this journey through nature has brought him wisdom, a sense of belonging, and a feeling of graduation as he re-enters civilization.
#0917 published 03:55 audio duration411 wordspoetrynaturevacationsealakes
I started my coding journey with simple visual tools that felt like a boardâgame, then moved through a stack of languagesâVisualâŻBasic, ASP, Perl, PHP and finally JavaScriptâlearning each from scratch projects such as a âFormMailâ clone and later building dragâandâdrop workflows reminiscent of Blenderâs Geometry Nodes. Along the way I discovered how powerful Gulpâs `parallel()` and `series()` functions are for automating tasks (e.g., resizing images in parallel, compressing and publishing sequentially), and I even practiced with the WarriorJs game where you program a characterâs moves via simple method calls. All of this shows that programming can be both playful and practical, turning any task into an automated, often overâengineered masterpiece.
#0916 published 08:21 audio duration716 words6 linksprogrammingjavascriptweb-developmentgulpparallel-processingseries-functions
The post argues that learning is most effective when tailored to an individualâs own pace and interests; formal schooling often fails because it imposes fixed sequences and generic knowledge. To succeed in interviews and real work, one must build functional, exceptional knowledgeâespecially in software developmentâby creating personal projects such as inâmemory databases with distributed hash tables, documenting them, writing tutorials, and sharing plugins online. Starting early, a learner should map their curiosities into a mindâmap, iteratively exploring new topics and building side projects that evolve into businesses; this cycle of selfâeducation yields true expertise beyond rote diplomas.
Each child is a unique creation, and humanity must craft a culture that inspires, nurtures, and educatesâan architecture of art where wisdom, not manipulation, guides life. The post argues that wars, borders, and cults are arbitrary tricks that waste time and cause poverty; the remedy lies in simple yet profound ideas: clear, dignified schooling that builds abilities for future generations to fix climate and end war, while abandoning bad ideas, hate, and endless taking.
#0914 published 04:26 audio duration387 wordscultureeducationchildrengenerationsclimatewarpoverty
The poem celebrates humanityâs inherent beauty and freedom, arguing that broken cultures lose their nurturing power while compromises erode wisdom. It calls for unity, growth, and education that enlightens the young without stagnation; poverty is seen as a source of terror and war merely a temporary ceasefire. Schools should be free from cruelty, and the world belongs to future generationsâso we must become farâseeing wise beings.
#0913 published 02:19 audio duration174 wordspoetrycultureunityhumanity
The post explains that curiosity is simply noticing something newâlike learning to use a 3âD printerâwhile an idea is what emerges from that curiosity and can be developed into something useful or creative; the author illustrates this with examples such as building a multiâlayer 3âD printed wallet, telling a âyoâŻmamaâ joke he claims to have invented, and finally describing his new Lowbrowâart technique of using kitten head proportions to guide adult portrait drawings. He stresses that ideas are worth recording, nurturing, and never underestimating, because they can bring joy, laughter, and personal fulfillment when turned into tangible projects or artworks.
#0912 published 15:45 audio duration1,257 words1 linkideacuriosity3d printingwallet designlowbrow artportraitpainting
A young woman from an ancient city, inspired by a beautiful kitten, sought to master art and journeyed to a renowned artistic village where she consulted its wisest man. He instructed her to meditate, but after each meditation the woman returned with newly invented toolsâsightâsize, proportional divider, grid method, graphite paper, viewing frame, light box, camera obscuraâthat gradually shaped modern drawing techniques; yet each invention prompted the wise man to send her back, insisting on simplicity. After many experiments and days of practice, she finally understood that only a simple thumb measurement was needed, defeated the wise man in front of the village, and thus proved her mastery. The tale concludes with the moral that those who impede artâwhether by belittling, profiting, or claiming wisdomâwill be remembered as fools.
#0911 published 04:31 audio duration306 words11 linksstorymythartinventiondrawing toolscamera obscuralightboxgridmethodgraphitepaperviewingframekrita
The post explains that starting an art practice by using reference images directlyâoften called âtracingââlets you learn quickly and build a personal style through shortcuts and visual pleasure. It recommends beginning with affordable tools like a $50 pen, tablet, and free software such as Krita to access its referenceâimage tool and create your own compositions. Once you master laying out scenes from references, you can shift to freehand drawing while still grounding yourself in realistic physics, but also bending reality to invent colors and light. The author illustrates this with an example of painting a politicianâs face: study the eyes and laughter from references, then compose the final piece freehand, ensuring harmony and purpose behind each sketch.
#0910 published 06:36 audio duration527 words2 linksreference-imageskritafreehandhyperrealistic
The author reflects on reshaping our world by uniting cultures through education, arguing that only by ending global povertyâvia universal income banks and free schoolingâcan people rise from low levels of learning. He stresses the need for a topâdown design that brings all cultures together, uses art to show students what a classroom should be, and believes this educational revolution will lift minds and dissolve borders.
#0909 published 03:12 audio duration273 words2 linkspoetryeducationglobalpovertyuniversalbasicincomeartculture