Use a narrated version of BillâŻBrysonâs âShort History of NearlyâŻEverythingâ as the scaffold for your selfâeducationâlisten to it instead of reading it. Choose your own path, guided by great achievements rather than family or culture, and be careful who you call âgreat,â because many pretend to know more than they do. Rely on wise books (especially narrated ones) as real teachers; memorization is only a testâpassing trick used by some teachers to sell out for paychecks. Start early with something lightâweight like programming, build startups at your own pace, and keep synthesizing knowledge from those books to unlock your genius.
#1003 published 09:08 audio duration603 words5 linksbill-brysonshort-history-of-nearly-everythingaudio-bookself-studyprogrammingartmusic
The post celebrates the idea that each person is a selfâsufficient adventurer and creator, not merely a worker or poor soul; it suggests that poverty, hunger, and homelessness arise from a lack of learning rather than effort. By issuing a simple universal income cardâcoded in fewer than 500 linesâeach human could be guaranteed a steady livelihood without disrupting regional economies. The author then turns to the power of books: they are the âtreasuresâ that carry wisdom across generations, enabling one to become a thinker, philosopher, artist, and composer; they also guide travelers on trails like the Appalachian and Pacific Crest. Finally, by turning what we learn into poetry and stories, we preserve our spirits for future friends. The piece ends with an invitation to selfâeducation and curiosity, promising that through such learning each person can rise from âworkerâ to âgreat being,â becoming part of humanityâs launch toward a universe where knowledge and creativity light the stars.
#1002 published 25:48 audio duration513 wordspoetrybookshikingtrailsadventureliteraturecreative-writinglearning
The post celebrates personal growth and selfâdefinition, urging the reader to continually rise above their own âcommon levelsâ and build a unique character through daily progress. It reminds us that we are born of stars, capable of defining ourselves and becoming wise by learning from books and adventures. The writer encourages living firmly in the universe, keeping each day better than the last, and believing that constant rising is what lets the world grow.
#1001 published 04:19 audio duration233 wordspoetrymotivationgrowthlifeself-development
Programming becomes engaging when itâs taught with real projects, not just theoryâsideâprojects let you learn by doing, while working for others keeps your future in your own hands. The post proposes building a tiny operating system entirely inside PouchDB: each document is a file or folder, and a simple file manager can open âwindowsâ that are themselves documents. By adding CodeMirror as an editor and xterm.js as a terminal you can manage the files from the command line, sync across machines via CouchDB, and eventually run a full webâbased OS. This DIY approach is not only fun but also portfolioâboosting; it opens a market for userâbuilt apps on your platform, with small revenue shares, while dragâandâdrop builders can generate productionâready code that users host themselves. In short, the article argues that programming is never dullâwhen you build, invent, and own your tools, it becomes a living art form.
#1000 published 10:53 audio duration613 words3 linkspouchdbcodemirrorxtermjsfilesystemoperatingsystemjavascriptwebappcodeeditorselflearning
In this poetic essay the author argues that the secret to building large empires lies in keeping things âcute and tinyââsmall, elegant algorithms and data structures such as twoâbranch trees. He illustrates how even the ranking engine of a onceâuseful search site and the AI powering the biggest video site are built from simple, compact components. The essay then turns into a practical blueprint: by offering developers an easyâtoâimport fileâsystem library that stores files in memory (with optional expiration and checksum filenames), one can create a lightweight, scalable storage service that many programmers will automatically adopt for their test code, thereby generating a growing empire of users and data. The author concludes that such small, versatile building blocks are the only way to grow a large empire.
#0999 published 05:52 audio duration377 wordsprogrammingfile-systemin-memory-storageweb-servicepaste-binhash-based-namessmall-library
The post argues that ending poverty for all people worldwide hinges on a universal income card, but this alone is insufficient without ârealâ schools that deliver tangible results; it criticizes current schooling systems as shameâbased and punitive, and proposes that learning computer programmingâan accessible skill with abundant selfâstudy resourcesâprovides individuals the ability to create digital goods stores, connect creators and consumers, and generate income that can fund real schools, thereby enabling communities to lift themselves out of poverty through cooperative entrepreneurship.
#0998 published 05:52 audio duration394 wordspovertyuniversal income cardschoolsprogrammingjavascriptdigital goods storeself education
A selfâreferential systemâlike the âWikiWikiâ ideaâlets a page edit itself by treating side menus, layout templates, and even server configuration as editable articles; with a simple edit button and a small markup syntax (e.g., `[include ArticleName]`) an editor can pull any articleâincluding the one being editedâinto the page, enabling infinite loops that make good Easterâegg material such as a chatbot that converses with itself in the style of Eliza. By treating program construction as a collection of files and directories (as in PlanâŻ9), developers can build applications where each step is an editable file, assign bounties to tasks, receive alerts when completed, and ultimately assemble a fully functional application simply by managing its files rather than writing code from scratch.
#0997 published 09:02 audio duration586 words2 linkswikiprogrammingself-referentialfile-systemplan9automatorweb-editing
The post argues that selfâeditable applicationsâthose built by dragging and dropping JavaScript actions without codingâoffer a powerful way for developers to create easyâtoâmanage business tools. By bundling editable programs in the app, users can extend or fix bugs themselves, much like tweaking formulas in spreadsheets. The author cites Apple Automator as a simple example, and suggests that with modern tech such as CouchDB, Svelte, PouchDB views, Gun.js, IPFS and ZeroMQ, one can build web apps (news readers, theme designers, code generators) that sync automatically. He proposes a business model where the app is free for nonâcommercial use but monetized when customers generate revenue, encouraging users to bring their own server and allowing the developer to take a small percent of sales.
#0996 published 06:16 audio duration463 words2 linksdraganddropjavascriptsveltecouchdbpouchdbgunjsipfszeromqautomatorwebapps
In this whimsical poem, winterâs chill invites us to treat small, lucky creaturesâwhether playful squirrels or âmini kittensââwith warmth, food, and care; by scattering nuts and offering a cozy home, we can keep them happy, proud, and affectionate, and in return they bring joy, companionship, and lasting good luck.
#0995 published 02:00 audio duration181 wordspoetryanimalswintermittenskittenssquirrelsnuts
The author argues that we have only enough time to tackle the root causes of global problemsâchiefly world poverty and a lack of real educationârather than merely treating their symptoms, which will never bring lasting change. He proposes âUniversal Income Cards,â computerâmanaged benefits that reset each midnight, as a concrete tool to lift people out of poverty; but he notes that politicians will use such ideas for political gain until the system is properly understood and implemented by truly educated leaders. The solution, he says, requires creativity, brilliance, and hackerâlike ingenuity to design deployment strategies (e.g., giving cards to those born after a set date so future generations can plan ahead). By freeing people from misery and opening borders, these cards could spark real schooling, disarm nations, and unify the world. He ends by urging selfâeducationâreading, listening, reâlisteningâto unleash hidden genius in all of us, because only by unlocking that talent can we finally hold a candle to the future and truly repair what our past generations failed to do.
#0994 published 14:52 audio duration1,151 wordspovertyuniversal-basic-incomeeducationpoliticscultureglobal unityself-education
Philosophyâthough misspelledâserves as a guiding force for human growth, cultivating authenticity, dignity, and noble character rather than mere obedience or convenience; it fuels intellectual fire, enriches minds, and provides continuity across generations by linking past research to future discoveries. Drawing on thinkers like Frankl and Martin Luther King Jr., the post argues that true happiness stems from character shaped by philosophyâs historical lineage. It presents philosophy as a family of wise humans whose collective wisdom builds armor around our being, enhances systems, and offers insight into all curiosities. By teaching it early, we could eradicate poverty, hunger, homelessness, mass incarceration, and strengthen educationâphilosophy is portrayed as the very culture that fixes everything in human life.
#0993 published 06:43 audio duration428 wordsphilosophyhumanitygrowthscienceeducationculture
The post argues that growing up without exposure to wise philosophy books signals a cultural failure, noting how dictatorships burn them and modern societies neglect them. It stresses that teachers often overlook the power of narrated texts, which can expand a childâs vocabulary and understanding, and calls for a readyâmade, accessible collection of the best parts of great booksâan easy gift parents can give to spark learning. By combining reading with listening, children can fully grasp what books are like, preventing the loss of knowledge that occurs when books become boring or optional.
#0992 published 07:24 audio duration606 wordsbooksreadingnarrationchildreneducationteacherslibrary
The post celebrates continuous learning and creative growth: upgrading systems expands everything, and the more we know the more we grow and encompass a multitude of ideas. It links this process to artâmusic, programming, writing, poetryâand frames each component as part of a concept map that can be connected and reconnected like pixels turning into notes. The writer muses on how fire and sunset scenes inspire reflection, while selfâeducation emerges as the sole true form of learning.
#0991 published 02:28 audio duration194 wordspoetrymusicprogrammingconcept-mapself-learningartwriting
The author argues that while there are countless ways to live, a few fundamental truthsâsuch as those championed by thinkers like Rand, Sagan, GellâMann, King Junior and Thoreauâremain constant; he urges the present generation to urgently revitalize education, nurture brilliant ideas that will endure beyond the inevitable fade of novelty, and actively transmit these ideas through tangible media (journals, typewriters, cassette recorders) so that future generations can inherit, build upon, and ultimately become giants in their own right.
#0990 published 05:01 audio duration300 wordsessayphilosophyeducationgenerationinspiration
Programming should be central to education because it teaches how to learn, making learning more efficient and meaningful; students can build useful projects instead of memorizing facts, leading to clearer future plans and selfâdriven preparation for startups. By focusing on programming, lessons become practical rather than abstract, reducing student boredom and giving them tangible results that motivate further study. With abundant free tutorials, learners can start with little cost or resources, making the subject accessible and promising a bright future.
#0989 published 04:40 audio duration343 words1 linkprogrammingeducationtutorialssvelteself-learningstartups
This post explains how combining CouchDB on the server, PouchDB in the browser, and Svelteâs storeâbased data binding turns the tedious problem of UI synchronization into a simple, automatic process: values are wrapped with unique identifiers for storage and tracking so that any change is immediately reflected in the UI without extra code. The author illustrates this with a basic âa = 1; x = a + aâ example, showing how most frameworks overâcomplicate variable monitoring, whereas CouchDB/PouchDB/Svelte handles it natively. By treating even lowâlevel sensor data (e.g., RPMs or GPIO reads) as CouchDB objects and using tiny filter programs, developers can build networked applications that update automatically with just a few lines of code, making the whole approach both powerful and surprisingly straightforward.
#0988 published 06:10 audio duration445 wordscouchdbpouchdbsveltesvelte-storedata-bindingui-updatedata-sync
The post argues that true learning comes from listening to narrated books instead of simply reading them, presenting a âsimple formulaâ that involves the present self, accumulated knowledge, and future self to undo ineffective education; it stresses that every person has a right to real knowledge, that libraries and wellâread librarians hold the essential nonâfiction works, and that by hearing these works one can build perception, wisdom, culture, and meaningâthus avoiding the regrets of an older self who would have benefited from powerful books in youth.
#0987 published 05:24 audio duration327 words1 linkaudiobookbooksreadingpersonal-developmenteducation
The post outlines a simple yet scalable system architecture that lets each user own a tiny personal databaseâbacked by Couchbase or CouchDB and synchronized via PouchDB on the client sideâso that changes made in the browser are automatically stored back to their own serverâside store. It explains how to build a custom designâdocument editor (modeled after Windows Explorer) for creating views, then shows how a programmer could pull news posts into each userâs database and expose them through a simple row navigator. From there it describes adding dragâandâdrop UI tools that let users assemble layouts, link image URLs to UI elements, and even chain actions like an Automator clone. The resulting product is a subscriptionâbased, perâuser app builder where programmers can contribute reusable components that become available to all subscribers, thereby expanding the âbusiness empireâ of userâgenerated apps.
#0986 published 10:47 audio duration670 words6 linkscouchdbpouchdbcouchbasedesign-documentdrag-and-dropapplication-builderjavascriptdatabasearchitecture
Books hold humanityâs greatest thoughts and ideas, yet most of them remain unread; they are meant to be heard as music rather than merely perused in paper form. A library is like a buffetâif you only eat the same few dishes youâll never return. To truly inherit a bookâs wisdom one must actively engage with it, sometimes through distress or adventure, and even take long journeys such as walking the Appalachian Trail to cultivate perseverance. By challenging ourselves and âplayingâ each book we design our own mental software, following Dennettâs question: if brains are computers, who designs the software? The answer lies in reading a wide range of booksâhundreds at leastâto fill the cultural void that has long forgotten its best ideas. Thus, by loving every second we listen to these works, we can transform the world into a wiser, more peaceful place.
#0985 published 12:02 audio duration421 words1 linkbooksreadingliteraturemusic-analogiesdennettaudiobooksculturehistory
The post argues that modern teaching often fails to convey true learning, with teachers who are unprepared, overburdened, and sometimes deceptive, causing students to memorize instead of understand; it calls for a return to authentic educationâwhere knowledge flows naturally from curiosity rather than rote drillsâand suggests practical solutions such as audioâbook lectures, selfâdirect study in philosophy, science, and biographies, and handsâon software development that turns learning into real job skills; ultimately it proposes that students become their own teachers, using accessible devices and web applications to build a new kind of school that blends learning with remote work opportunities.
#0984 published 07:05 audio duration575 wordseducationteacherslearningaudio-bookssoftware-developmentweb-applicationbooksphilosophyself-learning
Programming is a discipline that sharpens clear thinking, encourages humility, and rewards deliberate learning over convenience. It teaches us to avoid letting personal favorites dictate our choicesâwhether we pick the easiest or most popular pathâand to choose languages and tools based on their fit for the problem at hand, rather than on tradition or gradeâfocusing curricula. For example, JavaScriptâs early slowness gave way to a powerful web language that is now indispensable. When building UI, a single wellâplaced logic statement can keep an animated buttonâs click handler from firing too early; separating UI and program logic keeps complexity in check. Exposure to such controlled challenges trains intellectual hygiene: we see the âhoodâ of code, design our own sequence of learning, and pace it to match our existing knowledge. Finally, programmingâs instant feedback loop lets us examine errors and revisit theory, ensuring nothing is skipped and every concept is truly understood.
#0983 published 04:15 audio duration421 words1 linkprogrammingjavascriptuianimationevent-handlingcode-simplificationdebugging
The post describes a creative way to embed a âfileâmanagerâ style interface inside a phone or web application, using a treeâlike data structure built from simple node and edge arrays rather than recursive objects. By closing the main app with a magic key combination you can drop into this hidden file manager, which mirrors the applicationâs structure and represents all user resources; it serves as both a development aidâletting you remember code and track listenersâand a prototyping platform, enabling tools such as a form designer, theme generator, or finiteâstate machine builder that output ready JavaScript via templates like EJS. Ultimately, this selfâeditable system becomes a sellable product (e.g., a theme with bundled generators) that lets buyers generate, customize, and run applications directly in the browser, offering both practical utility for new projects and potential side income.
#0982 published 04:58 audio duration449 wordsfile managertree structurenode arrayedge arrayobject oriented nodesjavascriptejs templatespouchdbtheme developmentcode generatorfinite state machine
The post introduces âpotatoesâ as a lightweight abstraction for CouchDB documents that makes it easier to keep data in sync across a networked application and the user interface. Each potato has a unique ID and revision number, so changes are stored as separate files and the latest revision is chosen by sorting filenamesâan eventualâconsistency approach that works even when many users update concurrently. By treating potatoes like Svelte stores or Bootstrap components, the author shows how UI elements can automatically refresh whenever a new winner revision appears, while âviewsâ (small programs) filter changes to build the visible collection of potatoes. The article explains that this model supports simple list handling, page reâcalculation, and fast searches, all while keeping the system free from overwrites or hacks because each change is uniquely identified and propagated through Pouch/Couch or a custom storage layer.
#0981 published 15:37 audio duration1,107 wordscouchdbpouchdbsveltejavascripteventual-consistencydocument-storeui-componentsbootstrap